PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG403300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 289aa    MW: 31971 Da    PI: 4.3017
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG403300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.91.1e-203487356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         k++++t+eq++ Le+ Fe+++++  e+++eLA+klgL+ rqV vWFqNrRa++k
  Pavir.1NG403300.2.p 34 KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWK 87
                         5678*************************************************9 PP

2HD-ZIP_I/II131.53.1e-4233125193
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekkrrl+ eqv+lLE+sFeee+kLeperK+elar+LglqprqvavWFqnrRAR+ktkqlE+d+++Lk+++dal+++++ L +++++Lr++
  Pavir.1NG403300.2.p  33 EKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLERDFDRLKASFDALRADHDLLLQDNHRLRSQ 122
                          69**************************************************************************************99 PP

          HD-ZIP_I/II  91 lke 93 
                          +++
  Pavir.1NG403300.2.p 123 VAS 125
                          975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.49E-202891IPR009057Homeodomain-like
PROSITE profilePS5007118.222989IPR001356Homeobox domain
SMARTSM003892.0E-203293IPR001356Homeobox domain
PfamPF000466.2E-183487IPR001356Homeobox domain
CDDcd000863.65E-203490No hitNo description
Gene3DG3DSA:1.10.10.606.7E-223596IPR009057Homeodomain-like
PRINTSPR000311.7E-66069IPR000047Helix-turn-helix motif
PROSITE patternPS0002706487IPR017970Homeobox, conserved site
PRINTSPR000311.7E-66985IPR000047Helix-turn-helix motif
PfamPF021834.0E-1789131IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MLGLEEGRGV KRPFFTSPDE LLEEEYYDEQ LPEKKRRLTP EQVHLLERSF EEENKLEPER  60
KTELARKLGL QPRQVAVWFQ NRRARWKTKQ LERDFDRLKA SFDALRADHD LLLQDNHRLR  120
SQVASLTEKL QEKEVTEGGV SADADAAALP VDAKVPLADD VEEPAAEAFE EQQVKSEDRL  180
STGSGGSAVV DTDALLCGRF AAAVDSSVES YFPGGEDHYH DCGMGPVNHC PGGIQSDDDG  240
AGSDEGCSYY PEEEAAAAAV AAAFFAGHAH PHAEDDEDAG QIGWWMWN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18189RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.69860.0callus| leaf| root| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9619490.0EU961949.1 Zea mays clone 239214 homeodomain leucine zipper protein CPHB-5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953793.11e-160PREDICTED: homeobox-leucine zipper protein HOX16-like isoform X1
RefseqXP_004953794.11e-160PREDICTED: homeobox-leucine zipper protein HOX16-like isoform X2
SwissprotQ6YWR41e-121HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16
SwissprotA2X9801e-121HOX16_ORYSI; Homeobox-leucine zipper protein HOX16
TrEMBLK3YU431e-160K3YU43_SETIT; Uncharacterized protein
TrEMBLK3YUQ01e-160K3YUQ0_SETIT; Uncharacterized protein
STRINGSi017789m1e-159(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.14e-63homeobox 1